General Information

  • ID:  hor006906
  • Uniprot ID:  P06759??22-101)
  • Protein name:  Apolipoprotein C-III
  • Gene name:  IL7
  • Organism:  Rattus norvegicus
  • Family:  Apolipoprotein C3 family
  • Source:  Animal
  • Expression:  Synthesized predominantly in liver and to a lesser degree in intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0042627 chylomicron; GO:0005615 extracellular space; GO:0034363 intermediate-density lipoprotein particle; GO:0034366 spherical high-density lipoprotein particle; GO:0034361 very-low-density lipoprotein particle
  • GO BP:  GO:0005543 phospholipid binding; GO:0070653 high-density lipoprotein particle receptor binding; GO:0030234 enzyme regulator activity; GO:0005319 lipid transporter activity; GO:0055102 lipase inhibitor activity
  • GO CC:  GO:0006641 triglyceride metabolic process; GO:0006642 triglyceride mobilization; GO:0070328 triglyceride homeostasis; GO:0034382 chylomicron remnant clearance; GO:0009410 response to xenobiotic stimulus; GO:0071333 cellular response to glucose stimulus; GO:0033344 cholesterol efflux; GO:0019433 triglyceride catabolic process; GO:0008203 cholesterol metabolic process; GO:0007186 G protein-coupled receptor signaling pathway; GO:0034375 high-density lipoprotein particle remodeling; GO:0006869 lipid transport; GO:0042157 lipoprotein metabolic process; GO:0042953 lipoprotein transport; GO:0060621 negative regulation of cholesterol import; GO:0045717 negative regulation of fatty acid biosynthetic process; GO:0010987 negative regulation of high-density lipoprotein particle clearance; GO:0050995 negative regulation of lipid catabolic process; GO:0042632 cholesterol homeostasis; GO:0010989 negative regulation of low-density lipoprotein particle clearance; GO:0045833 negative regulation of lipid

Sequence Information

  • Sequence:  EGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP
  • Length:  80
  • Propeptide:  MQPRMLLIVALVALLASARADEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP
  • Signal peptide:  MQPRMLLIVALVALLASARA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA